HPA001471

C1QC antibody from Sigma-Aldrich
C1QG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001471
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001471, RRID:AB_1078553
Product name
Anti-C1QC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001471
Antibody type
Polyclonal
Antigen
Complement C1q subcomponent subunit C precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSL
IRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHA
SHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGV
LLRLQVGEEVWLAVNDYYDMVGIQGSD
Storage
-20C
Provider Type Product Number
- No reagents -