HPA024292

FBXO43 antibody from Atlas Antibodies
Fbx43
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024292
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024292, RRID:AB_1848462
Product name
Anti-FBXO43
Provider product page
Atlas Antibodies - HPA024292
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ILPRKEKDKTPELCETPKISGKKCLPRRRLNVSFA
LLKGDFESQNSSLESSISQVINLEKNIPSSASGFS
RANNFSPLVTSTLKTEEVTSCSQKLRLNFSQQKTS
TIDDSKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -