HPA020432

C3 antibody from Atlas Antibodies
ARMD9, C3a, C3b, CPAMD1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020432
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020432, RRID:AB_1847118
Product name
Anti-C3
Provider product page
Atlas Antibodies - HPA020432
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLS
VPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLK
VVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPA
DLSDQVPDTESETRILLQGTPVAQMTEDAVDAERL
KHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -