Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002027 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002027, RRID:AB_1079324
- Product name
- Anti-MBL2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGN
KFFLTNGEIMTFEKVKALCVKFQASVATPRNAAEN
GAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYT
NWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Expression of mannose binding lectin in HIV-1-infected brain: implications for HIV-related neuronal damage and neuroAIDS.
Macrophage-Specific Expression of Mannose-Binding Lectin Controls Atherosclerosis in Low-Density Lipoprotein Receptor-Deficient Mice
Singh KK, Nathamu S, Adame A, Alire TU, Dumaop W, Gouaux B, Moore DJ, Masliah E, and HIV Neurobehavioral Research Center Group
Neurobehavioral HIV medicine 2011 May 1;3:41-52
Neurobehavioral HIV medicine 2011 May 1;3:41-52
Macrophage-Specific Expression of Mannose-Binding Lectin Controls Atherosclerosis in Low-Density Lipoprotein Receptor-Deficient Mice
Matthijsen R, de Winther M, Kuipers D, van der Made I, Weber C, Herias M, Gijbels M, Buurman W
Circulation 2009 April;119(16):2188-2195
Circulation 2009 April;119(16):2188-2195
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN