HPA002027

MBL2 antibody from Sigma-Aldrich
COLEC1, MBL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002027
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002027, RRID:AB_1079324
Product name
Anti-MBL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002027
Antibody type
Polyclonal
Antigen
Mannose-binding protein C precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGN
KFFLTNGEIMTFEKVKALCVKFQASVATPRNAAEN
GAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYT
NWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
Storage
-20C
Provider Type Product Number
- No reagents -