AV34806

ZNF627 antibody from Sigma-Aldrich
FLJ90365
No application information provided.

Antibody data

Product number
AV34806
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV34806, RRID:AB_1859385
Product name
Anti-ZNF627 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV34806
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF627 with an internal ID of P06014
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFRNLASVGKQWEDQNIEDPFKIPRRNISHIPERL
CESKEGGQGEETFSQ
Storage
-20C
Provider Type Product Number
- No reagents -