AV34806

ZNF627 antibody from MilliporeSigma / Merck KGaA
FLJ90365
No application information provided.

Antibody data

Product number
AV34806
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ZNF627 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV34806
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF627 with an internal ID of P06014
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFRNLASVGKQWEDQNIEDPFKIPRRNISHIPERL
CESKEGGQGEETFSQ
Storage
-20C