Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310674 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein tyrosine Phosphatase, Non-Receptor Type 2 (PTPN2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PTPN2 antibody: synthetic peptide directed towards the N terminal of human PTPN2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHS
RVKLQ NAENDYINAS- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel mechanism for imatinib mesylate (STI571) resistance in CML cell line KT-1: role of TC-PTP in modulating signals downstream from the BCR-ABL fusion protein.
Shimizu T, Miyakawa Y, Iwata S, Kuribara A, Tiganis T, Morimoto C, Ikeda Y, Kizaki M
Experimental hematology 2004 Nov;32(11):1057-63
Experimental hematology 2004 Nov;32(11):1057-63
No comments: Submit comment
No validations: Submit validation data