HPA001578

C4BPA antibody from Sigma-Aldrich
C4BP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001578
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001578, RRID:AB_1078354
Product name
Anti-C4BPA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001578
Antibody type
Polyclonal
Antigen
C4b-binding protein alpha-chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLRGSSVIHCDADSKWNPSPPACEPNSCTNLPDIP
HASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTD
EPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEIT
QHRKSRPANHCVYFYGDEISFSCHETSRFSAICQG
DG
Storage
-20C
Provider Type Product Number
- No reagents -