HPA019055

CFAP298 antibody from Sigma-Aldrich
C21orf48, C21orf59, CILD26, FBB18, FLJ20467, Kur
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019055
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019055, RRID:AB_1845701
Product name
Anti-C21orf59 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019055
Antibody type
Polyclonal
Antigen
Uncharacterized protein C21orf59 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDESQFLLQAPGSTELEELTVQVARVYNGRLKVQR
LCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDE
WGEKCVPSGGAVFKKDDIGRRNG
Storage
-20C
Provider Type Product Number
- No reagents -