HPA019055

CFAP298 antibody from Atlas Antibodies
C21orf48, C21orf59, CILD26, FBB18, FLJ20467, Kur
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019055
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019055, RRID:AB_1845701
Product name
Anti-C21orf59
Provider product page
Atlas Antibodies - HPA019055
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDESQFLLQAPGSTELEELTVQVARVYNGRLKVQR
LCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDE
WGEKCVPSGGAVFKKDDIGRRNG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -