HPA019055

CFAP298 antibody from Atlas Antibodies
C21orf48, C21orf59, CILD26, FBB18, FLJ20467, Kur

Antibody data

Product number
HPA019055
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019055, RRID:AB_1845701
Product name
Anti-C21orf59
Provider product page
Atlas Antibodies - HPA019055
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDESQFLLQAPGSTELEELTVQVARVYNGRLKVQR
LCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDE
WGEKCVPSGGAVFKKDDIGRRNG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.