Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051135-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051135-M04, RRID:AB_804974
- Product name
- IRAK4 monoclonal antibody (M04), clone 2D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IRAK4.
- Antigen sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKL
AVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSEL
LFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAV
PKTANTLPSKEAITVQQKQMPFCDK- Isotype
- IgG
- Antibody clone number
- 2D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IRAK4 monoclonal antibody (M04), clone 2D3 Western Blot analysis of IRAK4 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IRAK4 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to IRAK4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol