HPA000924

IRAK4 antibody from Sigma-Aldrich
NY-REN-64
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000924
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000924, RRID:AB_1079147
Product name
Anti-IRAK4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000924
Antibody type
Polyclonal
Antigen
Interleukin-1 receptor-associated kinase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASL
LLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTL
MTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFS
FYELKNVTNNFDERPISVGGNKMGEGGFGVVY
Storage
-20C
Provider Type Product Number
- No reagents -