HPA001302

CASP8 antibody from Atlas Antibodies
Casp-8, FLICE, MACH, MCH5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001302
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001302, RRID:AB_1846057
Product name
Anti-CASP8
Provider product page
Atlas Antibodies - HPA001302
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVF
FIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQT
RYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSL
CQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMG
KQMPQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -