H00008772-D01P

FADD antibody from Abnova Corporation
GIG3, MORT1

Antibody data

Product number
H00008772-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008772-D01P, RRID:AB_1573473
Product name
FADD purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00008772-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human FADD protein.
Antigen sequence
MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRK
LERVQSGLDLFSMLLEQNDLEPGHTELLRELLASL
RRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVIC
DNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTER
VRESLRIWKNTEKENATVAHLVGALRSCQMNLVAD
LVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -