HPA001464

FADD antibody from Sigma-Aldrich
GIG3, MORT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001464
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001464, RRID:AB_1848348
Product name
Anti-FADD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001464
Antibody type
Polyclonal
Antigen
Protein FADD recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQND
LEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAG
AAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDT
KIDSIEDRYPRNLTERVRESLRIWKN
Storage
-20C
Provider Type Product Number
- No reagents -