HPA020887

ZNF20 antibody from Sigma-Aldrich
KOX13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020887
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020887, RRID:AB_2218842
Product name
Anti-ZNF20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020887
Antibody type
Polyclonal
Antigen
Zinc finger protein 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFQDSVAFEDVAVSFTQEEWALLDPSQKNLYRDVM
QETFKNLTSVGKTWKVQNIEDEYKNPRRNLSLMRE
KLCESKESHHCGESFNQIADDMLNR
Storage
-20C
Provider Type Product Number
- No reagents -