HPA001460

VRTN antibody from Sigma-Aldrich
C14orf115, FLJ10811, vertnin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001460
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001460, RRID:AB_1078318
Product name
Anti-C14orf115 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001460
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf115 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATLEAIFDADVKASCFPSSFSNVWHLYALASVLQR
NIYSIYPMRNLKIRPYFNRVIRPRRCDHVPSTLHI
MWAGQPLTSHFFRHQYFAPVVGLEEVEAEGAPGVA
PALPALAPLSSPAKTLELLNREPGLSYSHLC
Storage
-20C
Provider Type Product Number
- No reagents -