HPA004120

TPPP2 antibody from Sigma-Aldrich
C14orf8, CT152, p18, p25beta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004120
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004120, RRID:AB_2303582
Product name
Anti-TPPP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004120
Antibody type
Polyclonal
Antigen
Tubulin polymerization-promoting protien family membber 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDG
KTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKEL
GQKRFKGKSPDEVLENIYGLMEGKDPATTGATKAT
TVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGRE
EMT
Storage
-20C
Provider Type Product Number
- No reagents -