Antibody data
- Product number
- H00000100-D01
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000100-D01, RRID:AB_10718574
- Product name
- ADA MaxPab rabbit polyclonal antibody (D01)
- Provider product page
- Abnova Corporation - H00000100-D01
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human ADA protein.
- Antigen sequence
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRG
IALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMP
AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPH
LLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEG
ERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQ
TVVAIDLAGDETIPGSSLLPGHVQAYQEAVKSGIH
RTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLED
QALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAV
IRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDM
GFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKA
YGMPPSASAGQNL
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supportive validation
- Submitted by
-
Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ADA expression in transfected 293T cell line (H00000100-T01) by ADA MaxPab polyclonal antibody.Lane 1: ADA transfected lysate(40.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
-
Abnova Corporation (provider)
- Main image

- Experimental details
- ADA MaxPab rabbit polyclonal antibody. Western Blot analysis of ADA expression in Jurkat.
Supportive validation
- Submitted by
-
Abnova Corporation (provider)
- Main image

- Experimental details
- ADA MaxPab rabbit polyclonal antibody. Western Blot analysis of ADA expression in NIH/3T3.
Supportive validation
- Submitted by
-
Abnova Corporation (provider)
- Main image

- Experimental details
- ADA MaxPab rabbit polyclonal antibody. Western Blot analysis of ADA expression in human colon.
Supportive validation
- Submitted by
-
Abnova Corporation (provider)
- Main image

- Experimental details
- ADA MaxPab rabbit polyclonal antibody. Western Blot analysis of ADA expression in rat brain.
Supportive validation
- Submitted by
-
Abnova Corporation (provider)
- Main image

- Experimental details
- ADA MaxPab rabbit polyclonal antibody. Western Blot analysis of ADA expression in mouse kidney.
Supportive validation
- Submitted by
-
Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of ADA transfected lysate using anti-ADA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ADA purified MaxPab mouse polyclonal antibody (B01P) (H00000100-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol