HPA023884

ADA antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023884, RRID:AB_1844573
Product name
Anti-ADA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023884
Antibody type
Polyclonal
Antigen
Adenosine deaminase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVELHVHLDGSIKPETILYYGRRRGIALPANTAEG
LLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIK
RIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPI
PWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARS
ILCC
Storage
-20C
Provider Type Product Number
- No reagents -