HPA002022

WAS antibody from Sigma-Aldrich
IMD2, THC, WASP, WASPA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002022
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002022, RRID:AB_1080581
Product name
Anti-WAS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002022
Antibody type
Polyclonal
Antigen
Wiskott-Aldrich syndrome protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQA
GLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQL
PPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLS
LGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSG
KK
Storage
-20C
Provider Type Product Number
- No reagents -