HPA006487

KMT2B antibody from Sigma-Aldrich
CXXC10, HRX2, KIAA0304, MLL1B, MLL2, MLL4, TRX2, WBP7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006487
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006487, RRID:AB_1080587
Product name
Anti-AD000671.3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006487
Antibody type
Polyclonal
Antigen
Histone-lysine N-methyltransferase MLL4 (Myeloid/lymphoid or mixed-lineage leukemia protein 4) (WW domain-binding protein 7) (WBP-7) (Trithorax homolog 2) (Lysine N-methyltransferase 2D)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLLGTEPFQEEIVAAGAMGSSHGGPGDSSEEESSP
TSRYIHFPVTVVSAPGLAPSATPGAPRIEQLDGVD
DGTDSEAEAVQQPRGQGTPPSGPGVVRAGV
Storage
-20C
Provider Type Product Number
- No reagents -