HPA006040

NCF2 antibody from Atlas Antibodies
NOXA2, p67phox
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006040
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006040, RRID:AB_1854906
Product name
Anti-NCF2
Provider product page
Atlas Antibodies - HPA006040
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILG
LQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALAT
SMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLF
RPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFA
PLQPQAA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -