HPA002327

NCF2 antibody from Sigma-Aldrich
NOXA2, p67phox
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002327
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002327, RRID:AB_1079550
Product name
Anti-NCF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002327
Antibody type
Polyclonal
Antigen
Neutrophil cytosol factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPK
EVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRD
MVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKD
AWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADA
NNQTTEPQ
Storage
-20C
Provider Type Product Number
- No reagents -