HPA006040

NCF2 antibody from Sigma-Aldrich
NOXA2, p67phox
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006040
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006040, RRID:AB_1854906
Product name
Anti-NCF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006040
Antibody type
Polyclonal
Antigen
Neutrophil cytosol factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILG
LQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALAT
SMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLF
RPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFA
PLQPQAA
Storage
-20C
Provider Type Product Number
- No reagents -