Antibody data

Product number
ABIN1449806
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 709 (ZNF709) (N-Term) antibody
Provider product page
antibodies-online - ABIN1449806
Antibody type
Polyclonal
Antigen
A synthetic peptide directed towards the N-termina regionl of human ZNF709
Description
Protein A affinity column
Reactivity
Human
Host
Rabbit
Antigen sequence
KLRSHMVERLCERKEGSQFGETISQTPNPKPNKKT
FTRVKPYECSVCGKD
Epitope
N-Term
Vial size
0.1 mg
Concentration
1.0 mg/mL
Storage
Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -