AV36149

AC008758.1 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
AV36149
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36149, RRID:AB_1859348
Product name
Anti-ZNF564 (AB1) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36149
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF564 with an internal ID of P07477
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CGKVFMHHSSLSRHIRSHLGHKPYDYQEYGEKPYK
CKQCGKAFSSCQSFR
Storage
-20C
Provider Type Product Number
- No reagents -