AV39839

AC008758.1 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
AV39839
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV39839, RRID:AB_1859349
Product name
Anti-ZNF564 (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV39839
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF564 with an internal ID of P23455
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PYECKQCGKTFSYSSSFQRHERAHNGDKPYVKNVG
KLSFITQPSNTCENE
Storage
-20C
Provider Type Product Number
- No reagents -