HPA001535

IFNGR2 antibody from Sigma-Aldrich
AF-1, IFNGT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001535
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001535, RRID:AB_1078432
Product name
Anti-IFNGR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001535
Antibody type
Polyclonal
Antigen
Interferon-gamma receptor beta-chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQ
HYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADT
STAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLK
PSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
Storage
-20C
Provider Type Product Number
- No reagents -