HPA041647

GREB1L antibody from Atlas Antibodies
C18orf6, FLJ13687, KIAA1772

Antibody data

Product number
HPA041647
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041647, RRID:AB_2677597
Product name
Anti-GREB1L
Provider product page
Atlas Antibodies - HPA041647
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DEEEINTDHNESSEVSQSEGEPWPDIESFSKMPFD
VSVHDPKYSLMSLVYTEKLAGVKQEVIKESKVEEP
RKRETVSIMLTKYAAYNT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.