HPA001334

LIG4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001334
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001334, RRID:AB_1078689
Product name
Anti-LIG4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001334
Antibody type
Polyclonal
Antigen
DNA ligase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFK
TKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYF
IDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEY
RYSWDCSPLSMFRRHTVYLDSYA
Storage
-20C
Provider Type Product Number
- No reagents -