HPA002691

MRE11A antibody from Sigma-Aldrich
ATLD, MRE11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002691
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002691, RRID:AB_1079409
Product name
Anti-MRE11A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002691
Antibody type
Polyclonal
Antigen
Double-strand break repair protein MRE11A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EESASAFSADDLMSIDLAEQMANDSDDSISAATNK
GRGRGRGRRGGRGQNSASRGGSQRGRADTGLETST
RSRNSKTAVSASRNMSIIDAFKSTRQQPSRNVTTK
NYSEVIEVDESDVEEDIFPTTSKTDQRWSSTSSSK
Storage
-20C
Provider Type Product Number
- No reagents -