HPA014837

HACD3 antibody from Sigma-Aldrich
B-ind1, HSPC121, PTPLAD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014837
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014837, RRID:AB_1855914
Product name
Anti-PTPLAD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014837
Antibody type
Polyclonal
Antigen
Protein tyrosine phosphatase-like protein PTPLAD1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISI
TENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPV
YKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAP
DFDRWLDESDAEMELRAKEEERLNKLRLE
Storage
-20C
Provider Type Product Number
- No reagents -