HPA002350

C1QA antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002350
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002350, RRID:AB_1078552
Product name
Anti-C1QA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002350
Antibody type
Polyclonal
Antigen
Complement C1q subcomponent subunit A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVIT
NQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICL
SIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQ
LQQGDQVWVEKDPKKGHIYQGSEADSVFS
Storage
-20C
Provider Type Product Number
- No reagents -