SAB1401459

GPR50 antibody from Sigma-Aldrich
H9, Mel1c
Flow cytometry
Recommended by provider

Antibody data

Product number
SAB1401459
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401459, RRID:AB_10608139
Product name
Anti-GPR50 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401459
Antibody type
Polyclonal
Antigen
GPR50 (AAI03697.1, 1 a.a. ~ 617 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAM
VITIVVDLIGNSMVILAVTKNKKLRNSGNIFVVSL
SVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVG
FITGLSVVGSIFNIVAIAINRYCYICHSLQYERIF
SVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRT
YTCIFNYLNNPVFTVTIVCIHFVLPLLIVGFCYVR
IWTKVLAARDPAGQNPDNQLAEVRNFLTMFVIFLL
FAVCWCPINV
Storage
-20C
Provider Type Product Number
- No reagents -