HPA020134

URGCP antibody from Atlas Antibodies
DKFZp666G166, DKFZp686O0457, FLJ20654, KIAA1507, URG4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020134
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020134, RRID:AB_1858652
Product name
Anti-URGCP
Provider product page
Atlas Antibodies - HPA020134
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LIPVLKIDHSHVLVKVSSTDSDSFVKRIRAIVGNV
LRAPCRRVSVEDMAHAARKLGLKVDEDCEECQKAK
DRMERITRKIKDSDAYRRDELRLQGDPWRKAAQVE
KEFCQLQWAVDPPEKHRAE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -