HPA019879

URGCP antibody from Sigma-Aldrich
DKFZp666G166, DKFZp686O0457, FLJ20654, KIAA1507, URG4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019879
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019879, RRID:AB_1858651
Product name
Anti-AC004985.2-1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019879
Antibody type
Polyclonal
Antigen
Protein URG4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSLSEKQYFLRWMEWGLARVAQPRLRQPPETLLTL
RPKHGGTTDVGEPLWPEPLGVEHFLREMGQFYEAE
SCLVEAGRLPAGQRRFAHFP
Storage
-20C
Provider Type Product Number
- No reagents -