HPA014778

MS4A10 antibody from Atlas Antibodies
CD20L7, MS4A9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014778
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014778, RRID:AB_2669089
Product name
Anti-MS4A10
Provider product page
Atlas Antibodies - HPA014778
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNT
TQPKLLAPHQHEKSQKKSSLLKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -