PAB28666
antibody from Abnova Corporation
Targeting: SNW1
Bx42, FUN20, NCoA-62, Prp45, PRPF45, SKIIP, SKIP, SKIP1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28666 - Provider product page
- Provider
- Abnova Corporation
- Product name
- SNW1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SNW1.
- Antigen sequence
RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRT
SNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQA
WRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNR
FVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with SNW1 polyclonal antibody (Cat # PAB28666) at 1:100-1:500 dilution.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251MG sp, Lane 3: A-431 with SNW1 polyclonal antibody (Cat # PAB28666) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U373 MG with SNW1 polyclonal antibody (Cat # PAB28666) at 1-4 ug/mL shows positivity in nucleus.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum with SNW1 polyclonal antibody (Cat # PAB28666) shows strong nuclear and cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)