HPA002457

SNW1 antibody from Atlas Antibodies
Bx42, FUN20, NCoA-62, Prp45, PRPF45, SKIIP, SKIP, SKIP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002457
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002457, RRID:AB_1080047
Product name
Anti-SNW1
Provider product page
Atlas Antibodies - HPA002457
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRT
SNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQA
WRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNR
FVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -