HPA002457

SNW1 antibody from Sigma-Aldrich
Bx42, NCoA-62, Prp45, PRPF45, SKIIP, SKIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002457
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002457, RRID:AB_1080047
Product name
Anti-SNW1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002457
Antibody type
Polyclonal
Antigen
SNW domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRT
SNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQA
WRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNR
FVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKF
Storage
-20C
Provider Type Product Number
- No reagents -