HPA024386

CD55 antibody from Atlas Antibodies
CR, CROM, DAF, TC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024386
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024386, RRID:AB_1846319
Product name
Anti-CD55
Provider product page
Atlas Antibodies - HPA024386
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPG
EKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASL
KQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLT
CLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGG
ILFGATISF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -