Home > Search result > CD55 > HPA002190

HPA002190

antibody from Atlas Antibodies

Targeting: CD55 CR, CROM, DAF, TC

Provider product page for HPA002190

Immunohistochemistry

Antibody data

Antibody Data
Antigen structure
References [0]
Comments [0]
Validations
Western blot [1]
Immunohistochemistry [8]

Submit

Validation data

Product number: HPA002190 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA002190, RRID:AB_1078472
Product name: Anti-CD55
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFT MIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVP PTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQAT RSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHT CFTLTGLLGTLVTMG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CD55 protein structure - HPA002190 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and pancreas tissues using HPA002190 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong cytoplasmic positivity in pneumocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows weak cytoplasmic positivity in cells in glomeruli.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN