HPA002190

CD55 antibody from Sigma-Aldrich
CR, CROM, DAF, TC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002190
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002190, RRID:AB_1078472
Product name
Anti-CD55 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002190
Antibody type
Polyclonal
Antigen
Complement decay-accelerating factor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFT
MIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVP
PTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQAT
RSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHT
CFTLTGLLGTLVTMG
Storage
-20C
Provider Type Product Number
- No reagents -