Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008773-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008773-M01, RRID:AB_425782
- Product name
- SNAP23 monoclonal antibody (M01), clone 2F5-3D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SNAP23.
- Antigen sequence
MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQ
DAGTKTITMLDEQKEQLNRIEEGLDQINKDMRETE
KTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGD
GGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYI
KRITNDAREDEMEENLTQVGSILGNLKDMALNIGN
EIDAQNPQIKRITDKADTNRDRIDIANARAKKLID
S- Isotype
- IgG
- Antibody clone number
- 2F5-3D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SNAP23 expression in transfected 293T cell line by SNAP23 monoclonal antibody (M01), clone 2F5-3D4.Lane 1: SNAP23 transfected lysate (Predicted MW: 23.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SNAP23 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of SNAP23 transfected lysate using anti-SNAP23 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SNAP23 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SNAP23 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol