HPA001830

SNAP25 antibody from Atlas Antibodies
bA416N4.2, dJ1068F16.2, RIC-4, RIC4, SEC9, SNAP, SNAP-25
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001830
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001830, RRID:AB_888932
Product name
Anti-SNAP25
Provider product page
Atlas Antibodies - HPA001830
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISG
GFIRRVTNDARENEMDENLEQVSGIIGNLRHMALD
MGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATK
MLGSG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -