HPA001830

SNAP25 antibody from Atlas Antibodies
bA416N4.2, dJ1068F16.2, RIC-4, RIC4, SEC9, SNAP, SNAP-25
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001830
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001830, RRID:AB_1080039
Product name
Anti-SNAP25
Provider product page
Atlas Antibodies - HPA001830
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISG
GFIRRVTNDARENEMDENLEQVSGIIGNLRHMALD
MGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATK
MLGSG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -