HPA001830

SNAP25 antibody from Sigma-Aldrich
bA416N4.2, dJ1068F16.2, RIC-4, RIC4, SEC9, SNAP, SNAP-25
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001830
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001830, RRID:AB_1080039
Product name
Anti-SNAP25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001830
Antibody type
Polyclonal
Antigen
Synaptosomal-associated protein 25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSDAYKKAWGNNQDGVVASQPARVVDEREQMAISG
GFIRRVTNDARENEMDENLEQVSGIIGNLRHMALD
MGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATK
MLGSG
Storage
-20C
Provider Type Product Number
- No reagents -