Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00140735-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00140735-A01, RRID:AB_529785
- Product name
- DYNLL2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant DYNLL2.
- Antigen sequence
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIE
KDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET
KH- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Different microtubule motors move early and late endocytic compartments.
Loubéry S, Wilhelm C, Hurbain I, Neveu S, Louvard D, Coudrier E
Traffic (Copenhagen, Denmark) 2008 Apr;9(4):492-509
Traffic (Copenhagen, Denmark) 2008 Apr;9(4):492-509
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DYNLL2 polyclonal antibody (A01), Lot # 060516JCS1 Western Blot analysis of DYNLL2 expression in SJCRH30 ( Cat # L027V1 ).