HPA023892

TMEM245 antibody from Atlas Antibodies
C9orf5, CG-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023892
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023892, RRID:AB_1845828
Product name
Anti-TMEM245
Provider product page
Atlas Antibodies - HPA023892
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AELPGQVISMAASTLANLAISITGYESSSEDQPST
QPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGR
RRPEIGTFLRKKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -