PAB21618

TMEM245 antibody from Abnova Corporation
C9orf5, CG-2

Antibody data

Product number
PAB21618
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21618, RRID:AB_10962775
Product name
TMEM245 polyclonal antibody
Provider product page
Abnova Corporation - PAB21618
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TMEM245.
Antigen sequence
AELPGQVISMAASTLANLAISITGYESSSEDQPST
QPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGR
RRPEIGTFLRKKK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -